MAL (NM_002371) Human Recombinant Protein

CAT#: TP301256

Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a

Product Images

Coomassie blue staining of purified MAL protein (Cat# TP301256). The protein was produced from HEK293T cells transfected with MAL cDNA clone (Cat# RC201256) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201256 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSVFCFVATTTLI
  ILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYRHYHENIAAVVFSYIATLLYV
  VHAVFSLIRWKSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002362
• Locus ID: 4118
• UniProt ID: P21145, A0A024RE19
• Cytogenetics: 2q11.1
• Refseq Size: 1153
• Refseq ORF: 459
• Synonyms: MVP17; VIP17
• Summary: The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012]
• Protein Families: Transmembrane