Sarcosine Oxidase (PIPOX) (NM_016518) Human Recombinant Protein

CAT#: TP301274

Recombinant protein of human pipecolic acid oxidase (PIPOX)

Product Images

Coomassie blue staining of purified PIPOX protein (Cat# TP301274). The protein was produced from HEK293T cells transfected with PIPOX cDNA clone (Cat# RC201274) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201274 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE
  CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG
  LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL
  RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP
  EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
  FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057602
• Locus ID: 51268
• UniProt ID: Q9P0Z9
• Cytogenetics: 17q11.2
• Refseq Size: 2412
• Refseq ORF: 1170
• Synonyms: LPIPOX
• Summary: Metabolizes sarcosine, L-pipecolic acid and L-proline.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Glycine, serine and threonine metabolism, Lysine degradation, Metabolic pathways