Bcl x (BCL2L1) (NM_138578) Human Recombinant Protein
CAT#: TP301314
Recombinant protein of human BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201314 protein sequence
Red=Cloning site Green=Tags(s) MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF NRWFLTGMTVAGVVLLGSLFSRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | In vitro ubiquitination assay substrate (PMID: 28038320) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_612815 |
Locus ID | 598 |
UniProt ID | Q07817, Q07817-1, A0A0S2Z3C5 |
Cytogenetics | 20q11.21 |
Refseq Size | 2575 |
Refseq ORF | 699 |
Synonyms | Bcl-X; BCL-XL/S; BCL2L; BCLX; PPP1R52 |
Summary | The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403363 | BCL2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420078 | BCL2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403363 | Transient overexpression lysate of BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY420078 | Transient overexpression lysate of BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 325.00 |
|
PH301314 | BCL2L1 MS Standard C13 and N15-labeled recombinant protein (NP_612815) |
USD 2,055.00 |
|
TP720085 | Recombinant protein of human BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review