Bcl x (BCL2L1) (NM_138578) Human Recombinant Protein

CAT#: TP301314

Recombinant protein of human BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

PARK2 E3 ubiquitin ligase ubiquitinates BCL-XL in vitro. Recombinant proteins BCL-XL (OriGene TP301314) and PARK2 were incubated in HEPES buffer, pH 8.0 containing E1, E2, ubiquitin, and Mg2+-ATP. Reactions were cultured for 10 min at 30 C, then 30 - 60 min at 37 C, and reaction samples were subjected to Western blot analysis. Figure cited from Neoplasia, PMID: 28038320

• 

  Coomassie blue staining of purified BCL2L1 protein (Cat# TP301314). The protein was produced from HEK293T cells transfected with BCL2L1 cDNA clone (Cat# RC201314) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201314 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
  HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
  VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
  NRWFLTGMTVAGVVLLGSLFSRK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: In vitro ubiquitination assay substrate (PMID: 28038320)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612815
• Locus ID: 598
• UniProt ID: Q07817, Q07817-1, A0A0S2Z3C5
• Cytogenetics: 20q11.21
• Refseq Size: 2575
• Refseq ORF: 699
• Synonyms: Bcl-X; BCL-XL/S; BCL2L; BCLX; PPP1R52
• Summary: The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer