Bcl x (BCL2L1) (NM_138578) Human Recombinant Protein

CAT#: TP301314

Recombinant protein of human BCL2-like 1 (BCL2L1), nuclear gene encoding mitochondrial protein, transcript variant 1


  View other "BCL2L1" proteins (6)

USD 823.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Anti-Bcl-XL mouse monoclonal antibody, clone OTI4A9 (formerly 4A9)
    • 100 ul

USD 379.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "BCL2L1"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC201314 protein sequence
Red=Cloning site Green=Tags(s)

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATG
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERF
NRWFLTGMTVAGVVLLGSLFSRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bioactivity In vitro ubiquitination assay substrate (PMID: 28038320)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_612815
Locus ID 598
UniProt ID Q07817, Q07817-1, A0A0S2Z3C5
Cytogenetics 20q11.21
Refseq Size 2575
Refseq ORF 699
Synonyms Bcl-X; BCL-XL/S; BCL2L; BCLX; PPP1R52
Summary The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.