SCGN (NM_006998) Human Recombinant Protein

CAT#: TP301359

Purified recombinant protein of Homo sapiens secretagogin, EF-hand calcium binding protein (SCGN)

Product Images

Coomassie blue staining of purified SCGN protein (Cat# TP301359). The protein was produced from HEK293T cells transfected with SCGN cDNA clone (Cat# RC201359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201359 representing NM_006998
  Red=Cloning site Green=Tags(s)
  
  MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ
  DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH
  HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD
  VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008929
• Locus ID: 10590
• UniProt ID: O76038
• Cytogenetics: 6p22.2
• Refseq Size: 1492
• Refseq ORF: 828
• Synonyms: CALBL; DJ501N12.8; SECRET; SEGN; setagin
• Summary: The encoded protein is a secreted calcium-binding protein which is found in the cytoplasm. It is related to calbindin D-28K and calretinin. This protein is thought to be involved in KCL-stimulated calcium flux and cell proliferation. [provided by RefSeq, Jul 2008]