NDRG1 (NM_006096) Human Recombinant Protein
CAT#: TP301374
Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 2
View other "NDRG1" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201374 protein sequence
Red=Cloning site Green=Tags(s) MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006087 |
Locus ID | 10397 |
UniProt ID | Q92597 |
Cytogenetics | 8q24.22 |
Refseq Size | 3123 |
Refseq ORF | 1182 |
Synonyms | CAP43; CMT4D; DRG-1; DRG1; GC4; HMSNL; NDR1; NMSL; PROXY1; RIT42; RTP; TARG1; TDD5 |
Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. The encoded protein is necessary for p53-mediated caspase activation and apoptosis. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4D, and expression of this gene may be a prognostic indicator for several types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401840 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427604 | NDRG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401840 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
USD 396.00 |
|
LY427604 | Transient overexpression lysate of N-myc downstream regulated 1 (NDRG1), transcript variant 1 |
USD 396.00 |
|
PH301374 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_006087) |
USD 2,055.00 |
|
PH325609 | NDRG1 MS Standard C13 and N15-labeled recombinant protein (NP_001128714) |
USD 2,055.00 |
|
TP325609 | Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 1 |
USD 748.00 |
|
TP720621 | Purified recombinant protein of Human N-myc downstream regulated 1 (NDRG1), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review