C17orf75 (NM_022344) Human Recombinant Protein

CAT#: TP301416

Recombinant protein of human chromosome 17 open reading frame 75 (C17orf75)

Product Images

Coomassie blue staining of purified C17orf75 protein (Cat# TP301416). The protein was produced from HEK293T cells transfected with C17orf75 cDNA clone (Cat# RC201416) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201416 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLPSLQESMDGDEKELESSEEGGSAEERRLEPPSSSHYCLYSYRGSRLAQQRGDSEDGSPSGTNAETPSG
  DDFSLSLADTNLPSEVEPELRSFIAKRLSRGAVFEGLGNVASVELKIPGYRVGCYYCLFQNEKLLPETVT
  IDSERNPSEYVVCFLGGSEKGLELFRLELDKYIQGLKNNMNCEARGLESHIKSYLSSWFEDVVCPIQRVV
  LLFQEKLTFLLHAALSYTPVEVKESDEKTKRDINRFLSVASLQGLIHEGTMTSLCMAMTEEQHKSVVIDC
  SSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQVLENFKLKAIQDTNNLKRFIRQAEMNHYALFKC
  YMFLKNCGSGDILLKIVKVEHEEMPEAKNVIAVLEEFMKEALDQSF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071739
• Locus ID: 64149
• UniProt ID: Q9HAS0
• Cytogenetics: 17q11.2
• Refseq Size: 4599
• Refseq ORF: 1188
• Synonyms: NJMU-R1; SRI2
• Summary: As component of the WDR11 complex acts together with TBC1D23 to facilitate the golgin-mediated capture of vesicles generated using AP-1 (PubMed:29426865). May have a role in spermatogenesis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome