VPS37B (NM_024667) Human Recombinant Protein

CAT#: TP301432

Recombinant protein of human vacuolar protein sorting 37 homolog B (S. cerevisiae) (VPS37B)

Product Images

Coomassie blue staining of purified VPS37B protein (Cat# TP301432). The protein was produced from HEK293T cells transfected with VPS37B cDNA clone (Cat# RC201432) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201432 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLK
  ARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFID
  VYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPP
  PPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQP
  GFILQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078943
• Locus ID: 79720
• UniProt ID: Q9H9H4, A0A024RBU0
• Cytogenetics: 12q24.31
• Refseq Size: 2766
• Refseq ORF: 855
• Summary: Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Endocytosis