BRP44L (MPC1) (NM_016098) Human Recombinant Protein

CAT#: TP301461

Recombinant protein of human brain protein 44-like (BRP44L)

Product Images

Coomassie blue staining of purified MPC1 protein (Cat# TP301461). The protein was produced from HEK293T cells transfected with MPC1 cDNA clone (Cat# RC201461) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201461 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA
  YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057182
• Locus ID: 51660
• UniProt ID: Q9Y5U8
• Cytogenetics: 6q27
• Refseq Size: 977
• Refseq ORF: 327
• Synonyms: BRP44L; CGI-129; MPYCD; SLC54A1
• Summary: The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene. [provided by RefSeq, Aug 2012]