ORC4L (ORC4) (NM_002552) Human Recombinant Protein
CAT#: TP301587
Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2
View other "ORC4" proteins (17)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201587 protein sequence
Red=Cloning site Green=Tags(s) MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN CPTDVRQWATSSLSWL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002543 |
Locus ID | 5000 |
UniProt ID | O43929, A8K7H4 |
Cytogenetics | 2q23.1 |
Refseq Size | 6594 |
Refseq ORF | 1308 |
Synonyms | ORC4L; ORC4P |
Summary | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010] |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405645 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC405646 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC419257 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430562 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430563 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433812 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405645 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 |
USD 605.00 |
|
LY405646 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 |
USD 605.00 |
|
LY419257 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2 |
USD 396.00 |
|
LY430562 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 |
USD 396.00 |
|
LY430563 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 |
USD 396.00 |
|
LY433812 | Transient overexpression lysate of origin recognition complex, subunit 4 (ORC4), transcript variant 5 |
USD 396.00 |
|
PH301587 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_002543) |
USD 2,055.00 |
|
PH311713 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859526) |
USD 2,055.00 |
|
PH311723 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859525) |
USD 2,055.00 |
|
TP311713 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 |
USD 748.00 |
|
TP311723 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review