RFC3 (NM_002915) Human Recombinant Protein
CAT#: TP301655
Recombinant protein of human replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201655 protein sequence
Red=Cloning site Green=Tags(s) MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG LEGMMF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002906 |
Locus ID | 5983 |
UniProt ID | P40938, A0A024RDQ8 |
Cytogenetics | 13q13.2 |
Refseq Size | 2396 |
Refseq ORF | 1068 |
Synonyms | RFC38 |
Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405704 | RFC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419018 | RFC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430547 | RFC3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405704 | Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 2 |
USD 325.00 |
|
LY419018 | Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1 |
USD 325.00 |
|
LY430547 | Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 2 |
USD 325.00 |
|
PH301655 | RFC3 MS Standard C13 and N15-labeled recombinant protein (NP_002906) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review