BCL7B (NM_001707) Human Recombinant Protein
CAT#: TP301696
Recombinant protein of human B-cell CLL/lymphoma 7B (BCL7B)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201696 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG QEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001698 |
Locus ID | 9275 |
UniProt ID | Q9BQE9 |
Cytogenetics | 7q11.23 |
Refseq Size | 1729 |
Refseq ORF | 606 |
Summary | This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419788 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC433989 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419788 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B) |
USD 396.00 |
|
LY433989 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2 |
USD 396.00 |
|
PH301696 | BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698) |
USD 2,055.00 |
|
TP330990 | Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review