Hsp40 (DNAJB1) (NM_006145) Human Recombinant Protein
CAT#: TP301762
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1)
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201762 protein sequence
Red=Cloning site Green=Tags(s) MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE GLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGG FTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRT IPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 37.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006136 |
| Locus ID | 3337 |
| UniProt ID | P25685, Q6FHS4 |
| Cytogenetics | 19p13.12 |
| Refseq Size | 2419 |
| Refseq ORF | 1020 |
| Synonyms | Hdj1; Hsp40; HSPF1; RSPH16B; Sis1 |
| Summary | This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401851 | DNAJB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401851 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) |
USD 436.00 |
|
| PH301762 | DNAJB1 MS Standard C13 and N15-labeled recombinant protein (NP_006136) |
USD 2,055.00 |
|
| TP720929 | Purified recombinant protein of Human DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China