DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
CAT#: TP301793
Recombinant protein of human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201793 protein sequence
Red=Cloning site Green=Tags(s) MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQ QHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQ RIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGE SLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLD EILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVS DIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIRGPED QTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006221 |
Locus ID | 5425 |
UniProt ID | P49005, A0A087WWF6 |
Cytogenetics | 7p13 |
Refseq Size | 1648 |
Refseq ORF | 1407 |
Summary | This gene encodes the 50-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA). Expression of this gene may be a marker for ovarian carcinomas. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Mar 2012] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416786 | POLD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426719 | POLD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY416786 | Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2 |
USD 325.00 |
|
LY426719 | Transient overexpression lysate of polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1 |
USD 325.00 |
|
PH301793 | POLD2 MS Standard C13 and N15-labeled recombinant protein (NP_006221) |
USD 2,055.00 |
|
PH325794 | POLD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120690) |
USD 2,055.00 |
|
TP325794 | Recombinant protein of human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 1 |
USD 748.00 |
|
TP720925 | Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review