FUS (NM_004960) Human Recombinant Protein
CAT#: TP301808
Recombinant protein of human fusion (involved in t(12;16) in malignant liposarcoma) (FUS)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201808 protein sequence
Red=Cloning site Green=Tags(s) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | Transmission electron microscopy (PMID: 26286827) Co-immunoprecipitation (PMID: 27164932) In vitro kinase assay inhibitor (PMID: 29513652) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004951 |
Locus ID | 2521 |
UniProt ID | P35637, Q6IBQ5 |
Cytogenetics | 16p11.2 |
Refseq Size | 5119 |
Refseq ORF | 1578 |
Synonyms | ALS6; altFUS; ETM4; FUS1; HNRNPP2; POMP75; TLS |
Summary | This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401541 | FUS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401541 | Transient overexpression lysate of fused in sarcoma (FUS), transcript variant 1 |
USD 325.00 |
|
PH301808 | FUS MS Standard C13 and N15-labeled recombinant protein (NP_004951) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review