Aquaporin 3 (AQP3) (NM_004925) Human Recombinant Protein
CAT#: TP301856
Recombinant protein of human aquaporin 3 (Gill blood group) (AQP3)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201856 protein sequence
Red=Cloning site Green=Tags(s) MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN VKLAHVKHKEQI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | In vivo treatment (PMID: 25490291) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004916 |
Locus ID | 360 |
UniProt ID | Q92482 |
Cytogenetics | 9p13.3 |
Refseq Size | 1882 |
Refseq ORF | 876 |
Synonyms | AQP-3; GIL |
Summary | This gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting duct cells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transport of nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that water channels can be functionally heterogeneous and possess water and solute permeation mechanisms. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401543 | AQP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401543 | Transient overexpression lysate of aquaporin 3 (Gill blood group) (AQP3) |
USD 325.00 |
|
PH301856 | AQP3 MS Standard C13 and N15-labeled recombinant protein (NP_004916) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review