POLR2K (NM_005034) Human Recombinant Protein

CAT#: TP301957

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa (POLR2K)

Product Images

Coomassie blue staining of purified POLR2K protein (Cat# TP301957). The protein was produced from HEK293T cells transfected with POLR2K cDNA clone (Cat# RC201957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201957 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 6.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005025
• Locus ID: 5440
• UniProt ID: P53803, A0A024R9G0
• Cytogenetics: 8q22.2
• Refseq Size: 971
• Refseq ORF: 174
• Synonyms: ABC10-alpha; hRPB7.0; hsRPB10a; RPABC4; RPB7.0; RPB10alpha; RPB12
• Summary: This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase