ARHGAP1 (NM_004308) Human Recombinant Protein

CAT#: TP301966

Recombinant protein of human Rho GTPase activating protein 1 (ARHGAP1)

Product Images

Coomassie blue staining of purified ARHGAP1 protein (Cat# TP301966). The protein was produced from HEK293T cells transfected with ARHGAP1 cDNA clone (Cat# RC201966) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201966 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH
  QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL
  RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV
  LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI
  FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV
  PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
  KFLLDHQGELFPSPDPSGL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 50.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004299
• Locus ID: 392
• UniProt ID: Q07960
• Cytogenetics: 11p11.2
• Refseq Size: 3460
• Refseq ORF: 1317
• Synonyms: CDC42GAP; p50rhoGAP; RHOGAP; RHOGAP1
• Summary: This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein contains a SRC homology 3 domain and interacts with Bcl-2-associated protein family members. [provided by RefSeq, Aug 2012]