Fatty Acid Binding Protein 5 (FABP5) (NM_001444) Human Recombinant Protein

CAT#: TP301973

Recombinant protein of human fatty acid binding protein 5 (psoriasis-associated) (FABP5)

Product Images

Coomassie blue staining of purified FABP5 protein (Cat# TP301973). The protein was produced from HEK293T cells transfected with FABP5 cDNA clone (Cat# RC201973) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201973 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLG
  EKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001435
• Locus ID: 2171
• UniProt ID: Q01469, E7DVW5
• Cytogenetics: 8q21.13
• Refseq Size: 751
• Refseq ORF: 405
• Synonyms: E-FABP; EFABP; KFABP; PA-FABP; PAFABP
• Summary: This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
• Protein Pathways: PPAR signaling pathway