EZH2 (NM_004456) Human Recombinant Protein

CAT#: TP302054

Recombinant protein of human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1

Product Images

BDNF non-protein coding antisense transcript (BDNF-AS) interacts directly with EZH2 (OriGene TP302054) in the RNA EMSA. Lane 1 (left) shows the migration of free biotinylated BDNF-AS. The addition of increasing concentrations of EZH2 protein (lanes 2 and 3) markedly reduced this migration. The addition of unbiotinylated BDNF-AS (lane 4, right) reversed the effect of EZH2 on the migration of biotinylated BDNF-AS. Figure cited from J Biomol Screen, PMID: 26173710

• 

  Optimization of AlphaScreen assay conditions through titrating BDNF non-protein coding antisense transcript (BDNF-AS) in the presence of different concentrations of EZH2 protein (OriGene TP302054). Figure cited from J Biomol Screen, PMID: 26173710

• 

  Coomassie blue staining of purified EZH2 protein (Cat# TP302054). The protein was produced from HEK293T cells transfected with EZH2 cDNA clone (Cat# RC202054) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202054 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI
  LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD
  QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK
  ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS
  FHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKT
  PPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
  TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDV
  DTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQN
  RFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWG
  IFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNC
  YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 85.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: EMSA assay (PMID: 26173710)
  Binding assay (AlphaScreen) (PMID: 26173710)
  In vitro ubiquitination assay substrate (PMID: 27869166)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004447
• Locus ID: 2146
• UniProt ID: Q15910, A0A090N8E9
• Cytogenetics: 7q36.1
• Refseq Size: 2723
• Refseq ORF: 2253
• Synonyms: ENX-1; ENX1; EZH2b; KMT6; KMT6A; WVS; WVS2
• Summary: This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Transcription Factors