G0S2 (NM_015714) Human Recombinant Protein

CAT#: TP302063

Recombinant protein of human G0/G1switch 2 (G0S2)

Product Images

G0S2 inhibits triacylglycerol hydrolase (TAGH) activity in mouse and human skeletal muscles. TAGH was measured in the absence (control) or presence of recombinant human G0S2 (rhG0S2) (OriGene TP302063) in (B) mice soleus and extensor digitorum longus muscle (EDL) and (C) human vastus lateralis muscle. * p < 0.05 versus control. Figure cited from Mol Metab, PMID: 27408777

• 

  Coomassie blue staining of purified G0S2 protein (Cat# TP302063). The protein was produced from HEK293T cells transfected with G0S2 cDNA clone (Cat# RC202063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202063 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL
  ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme activity regulator (PMID: 27408777)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056529
• Locus ID: 50486
• UniProt ID: P27469
• Cytogenetics: 1q32.2
• Refseq Size: 978
• Refseq ORF: 309
• Summary: Promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane