NIP7 (NM_016101) Human Recombinant Protein
CAT#: TP302103
Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7)
View other "NIP7" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202103 protein sequence
Red=Cloning site Green=Tags(s) MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCF GKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057185 |
Locus ID | 51388 |
UniProt ID | Q9Y221 |
Cytogenetics | 16q22.1 |
Refseq Size | 2328 |
Refseq ORF | 540 |
Synonyms | CGI-37; HSPC031; KD93 |
Summary | Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414162 | NIP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414162 | Transient overexpression lysate of nuclear import 7 homolog (S. cerevisiae) (NIP7) |
USD 396.00 |
|
PH302103 | NIP7 MS Standard C13 and N15-labeled recombinant protein (NP_057185) |
USD 2,055.00 |
|
TP720548 | Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review