GCIP interacting protein p29 (SYF2) (NM_015484) Human Recombinant Protein

CAT#: TP302167

Recombinant protein of human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1

Product Images

Coomassie blue staining of purified SYF2 protein (Cat# TP302167). The protein was produced from HEK293T cells transfected with SYF2 cDNA clone (Cat# RC202167) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202167 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA
  KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK
  QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY
  INERNAKFNKKAERFYGKYTAEIKQNLERGTAV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056299
• Locus ID: 25949
• UniProt ID: O95926
• Cytogenetics: 1p36.11
• Refseq Size: 1777
• Refseq ORF: 729
• Synonyms: CBPIN; fSAP29; NTC31; P29
• Summary: This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome