GCIP interacting protein p29 (SYF2) (NM_015484) Human Mass Spec Standard

CAT#: PH302167

SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299)

Product Images

Coomassie blue staining of purified SYF2 protein (Cat# TP302167). The protein was produced from HEK293T cells transfected with SYF2 cDNA clone (Cat# RC202167) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202167
• Predicted MW: 28.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202167 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA
  KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK
  QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY
  INERNAKFNKKAERFYGKYTAEIKQNLERGTAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056299
• RefSeq Size: 1777
• RefSeq ORF: 729
• Synonyms: CBPIN; fSAP29; NTC31; P29
• Locus ID: 25949
• UniProt ID: O95926
• Cytogenetics: 1p36.11
• Summary: This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome