SNAP29 (NM_004782) Human Recombinant Protein
CAT#: TP302179
Recombinant protein of human synaptosomal-associated protein, 29kDa (SNAP29)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202179 protein sequence
Red=Cloning site Green=Tags(s) MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004773 |
Locus ID | 9342 |
UniProt ID | O95721 |
Cytogenetics | 22q11.21 |
Refseq Size | 4277 |
Refseq ORF | 774 |
Synonyms | CEDNIK; SNAP-29 |
Summary | This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401502 | SNAP29 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401502 | Transient overexpression lysate of synaptosomal-associated protein, 29kDa (SNAP29) |
USD 325.00 |
|
PH302179 | SNAP29 MS Standard C13 and N15-labeled recombinant protein (NP_004773) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review