ARMC8 (NM_014154) Human Recombinant Protein
CAT#: TP302341
Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 1
View other "ARMC8" proteins (11)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202341 protein sequence
Red=Cloning site Green=Tags(s) MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECA VVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLM ALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSM TLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLL EERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKL YASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054873 |
Locus ID | 25852 |
UniProt ID | Q8IUR7 |
Cytogenetics | 3q22.3 |
Refseq Size | 3236 |
Refseq ORF | 1155 |
Synonyms | GID5; HSPC056; S863-2; VID28 |
Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402281 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403732 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414566 | ARMC8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402281 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 1 |
USD 396.00 |
|
LY403732 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 3 |
USD 396.00 |
|
LY414566 | Transient overexpression lysate of armadillo repeat containing 8 (ARMC8), transcript variant 2 |
USD 396.00 |
|
PH302341 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_054873) |
USD 2,055.00 |
|
PH307532 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_056211) |
USD 2,055.00 |
|
PH315221 | ARMC8 MS Standard C13 and N15-labeled recombinant protein (NP_998819) |
USD 2,055.00 |
|
TP307532 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 2 |
USD 823.00 |
|
TP315221 | Recombinant protein of human armadillo repeat containing 8 (ARMC8), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review