ELMOD2 (NM_153702) Human Recombinant Protein

CAT#: TP302343

Recombinant protein of human ELMO/CED-12 domain containing 2 (ELMOD2)

Product Images

Coomassie blue staining of purified ELMOD2 protein (Cat# TP302343). The protein was produced from HEK293T cells transfected with ELMOD2 cDNA clone (Cat# RC202343) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202343 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEV
  DKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMP
  TKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGIN
  LTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKG
  LLLDCNVALTLKV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_714913
• Locus ID: 255520
• UniProt ID: Q8IZ81
• Cytogenetics: 4q31.1
• Refseq Size: 4425
• Refseq ORF: 879
• Synonyms: 9830169G11Rik
• Summary: This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by RefSeq, Sep 2010]