TTC33 (NM_012382) Human Recombinant Protein

CAT#: TP302360

Recombinant protein of human tetratricopeptide repeat domain 33 (TTC33)

Product Images

Coomassie blue staining of purified TTC33 protein (Cat# TP302360). The protein was produced from HEK293T cells transfected with TTC33 cDNA clone (Cat# RC202360) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202360 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASFGWKRKIGEKVSKVTSQQFEAEAADEKDVVDNDEGNWLHAIKRRKEILLEGCAEKSKQLKDEGASLA
  ENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQQNPHSWESWQTLGRAQLGL
  GEIILAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAQRIKKSEAPAEVTHFSPKSIPDYDFESDE
  IVAVCAAIAEKEKTVSANKTMVIVSASGAIETVTEKEDGATPPDGSVFIKAR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Enzyme substrate (PMID: 29804834)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036514
• Locus ID: 23548
• UniProt ID: Q6PID6
• Cytogenetics: 5p13.1
• Refseq Size: 5519
• Refseq ORF: 786
• Synonyms: OSRF