Cytochrome b5 (CYB5A) (NM_148923) Human Recombinant Protein

CAT#: TP302378

Recombinant protein of human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1

Product Images

Coomassie blue staining of purified CYB5A protein (Cat# TP302378). The protein was produced from HEK293T cells transfected with CYB5A cDNA clone (Cat# RC202378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST
  DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_683725
• Locus ID: 1528
• UniProt ID: P00167, A0A384ME44
• Cytogenetics: 18q22.3
• Refseq Size: 850
• Refseq ORF: 402
• Synonyms: CYB5; MCB5; METAG
• Summary: The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]
• Protein Families: Transmembrane