Cytochrome b5 (CYB5A) (NM_148923) Human Recombinant Protein
CAT#: TP302378
Recombinant protein of human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202378 protein sequence
Red=Cloning site Green=Tags(s) MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683725 |
Locus ID | 1528 |
UniProt ID | P00167, A0A384ME44 |
Cytogenetics | 18q22.3 |
Refseq Size | 850 |
Refseq ORF | 402 |
Synonyms | CYB5; MCB5; METAG |
Summary | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403451 | CYB5A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403451 | Transient overexpression lysate of cytochrome b5 type A (microsomal) (CYB5A), transcript variant 1 |
USD 325.00 |
|
PH302378 | CYB5A MS Standard C13 and N15-labeled recombinant protein (NP_683725) |
USD 2,055.00 |
|
TP720192 | Recombinant protein of human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 3. |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review