PPPDE1 (DESI2) (NM_016076) Human Recombinant Protein

CAT#: TP302524

Recombinant protein of human PPPDE peptidase domain containing 1 (PPPDE1)

Product Images

Coomassie blue staining of purified DESI2 protein (Cat# TP302524). The protein was produced from HEK293T cells transfected with DESI2 cDNA clone (Cat# RC202524) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202524 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFK
  EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPF
  LQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057160
• Locus ID: 51029
• UniProt ID: Q9BSY9, A0A024R5P6
• Cytogenetics: 1q44
• Refseq Size: 4109
• Refseq ORF: 582
• Synonyms: C1orf121; CGI-146; DESI; DeSI-2; DESI1; FAM152A; PNAS-4; PPPDE1
• Summary: Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization (PubMed:28483520).[UniProtKB/Swiss-Prot Function]