RBM4B (NM_031492) Human Recombinant Protein

CAT#: TP302569

Recombinant protein of human RNA binding motif protein 4B (RBM4B)

Product Images

Coomassie blue staining of purified RBM4B protein (Cat# TP302569). The protein was produced from HEK293T cells transfected with RBM4B cDNA clone (Cat# RC202569) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202569 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS
  KNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR
  MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMY
  YNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSG
  AAATSAAMAAAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQY
  VDRARYSAF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_113680
• Locus ID: 83759
• UniProt ID: Q9BQ04
• Cytogenetics: 11q13.2
• Refseq Size: 1844
• Refseq ORF: 1077
• Synonyms: RBM4L; RBM30; ZCCHC15; ZCCHC21B; ZCRB3B
• Summary: Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3' UTR of the PER1 mRNA (By similarity).[UniProtKB/Swiss-Prot Function]