NME4 (NM_005009) Human Recombinant Protein

CAT#: TP302603

Recombinant protein of human non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified NME4 protein (Cat# TP302603). The protein was produced from HEK293T cells transfected with NME4 cDNA clone (Cat# RC202603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202603 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG
  MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD
  FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005000
• Locus ID: 4833
• UniProt ID: O00746
• Cytogenetics: 16p13.3
• Refseq Size: 1059
• Refseq ORF: 561
• Synonyms: NDPK-D; nm23-H4; NM23H4
• Summary: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism