RPRM (NM_019845) Human Recombinant Protein

CAT#: TP302634

Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM)


  View other "RPRM" proteins (3)

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "RPRM"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC202634 protein sequence
Red=Cloning site Green=Tags(s)

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.6 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062819
Locus ID 56475
UniProt ID Q9NS64
Cytogenetics 2q23.3
Refseq Size 1496
Refseq ORF 327
Synonyms REPRIMO
Summary May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Protein Pathways p53 signaling pathway

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.