SERPINB3 (NM_006919) Human Recombinant Protein

CAT#: TP302683

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 3 (SERPINB3)

Product Images

Coomassie blue staining of purified SERPINB3 protein (Cat# TP302683). The protein was produced from HEK293T cells transfected with SERPINB3 cDNA clone (Cat# RC202683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202683 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA
  ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP
  EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI
  QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV
  DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV
  GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008850
• Locus ID: 6317
• UniProt ID: P29508
• Cytogenetics: 18q21.33
• Refseq Size: 1793
• Refseq ORF: 1170
• Synonyms: HsT1196; SCC; SCCA-1; SCCA-PD; SCCA1; SSCA1; T4-A
• Summary: May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein