Insulin (INS) (NM_000207) Human Recombinant Protein

CAT#: TP302701

Recombinant protein of human insulin (INS)

Product Images

The proliferation of HPDE-6 cells under high-insulin conditions. After 120 hours of culture under different concentrations of glucose (6, 30, and 60 mM), and insulin (OriGene TP302701) (0, 0.1, and 1 nM), the cell growth was assessed by the MTT assay. * p < 0.001; ** p < 0.01; *** p < 0.05; NS: non-significant. Figure cited from Int J Mol Sci, PMID: 28417915

• 

  Coomassie blue staining of purified INS protein (Cat# TP302701). The protein was produced from HEK293T cells transfected with INS cDNA clone (Cat# RC202701) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202701 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG
  GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 28417915)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000198
• Locus ID: 3630
• UniProt ID: P01308, I3WAC9
• Cytogenetics: 11p15.5
• Refseq Size: 469
• Refseq ORF: 330
• Synonyms: IDDM; IDDM1; IDDM2; ILPR; IRDN; MODY10; PNDM4
• Summary: This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified, including insulin-dependent diabetes mellitus, permanent neonatal diabetes diabetes mellitus, maturity-onset diabetes of the young type 10 and hyperproinsulinemia. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. [provided by RefSeq, May 2020]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Insulin signaling pathway, Maturity onset diabetes of the young, mTOR signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Regulation of autophagy, Type I diabetes mellitus, Type II diabetes mellitus