MSMB (NM_002443) Human Recombinant Protein
CAT#: TP302704
Recombinant protein of human microseminoprotein, beta- (MSMB), transcript variant PSP94
View other "MSMB" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202704 protein sequence
Red=Cloning site Green=Tags(s) MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCC TLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002434 |
Locus ID | 4477 |
UniProt ID | P08118 |
Cytogenetics | 10q11.22 |
Refseq Size | 503 |
Refseq ORF | 342 |
Synonyms | HPC13; IGBF; MSP; MSPB; PN44; PRPS; PSP; PSP-94; PSP57; PSP94 |
Summary | The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400872 | MSMB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400872 | Transient overexpression lysate of microseminoprotein, beta- (MSMB), transcript variant PSP94 |
USD 396.00 |
|
PH302704 | MSMB MS Standard C13 and N15-labeled recombinant protein (NP_002434) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review