LXN (NM_020169) Human Recombinant Protein

CAT#: TP302769

Recombinant protein of human latexin (LXN)

Product Images

Coomassie blue staining of purified LXN protein (Cat# TP302769). The protein was produced from HEK293T cells transfected with LXN cDNA clone (Cat# RC202769) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202769 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNC
  TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLA
  WVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK
  HNSRLPKEVQLE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064554
• Locus ID: 56925
• UniProt ID: Q9BS40
• Cytogenetics: 3q25.32
• Refseq Size: 1132
• Refseq ORF: 666
• Synonyms: ECI; TCI
• Summary: This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. The encoded protein, latexin, downregulates the population size of hematopoietic stem cells. This protein is found to be downregulated in cancer cells because of promoter hypermethylation. [provided by RefSeq, Jul 2020]