PSMA4 (NM_002789) Human Recombinant Protein
CAT#: TP302786
Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202786 protein sequence
Red=Cloning site Green=Tags(s) MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002780 |
Locus ID | 5685 |
UniProt ID | P25789 |
Cytogenetics | 15q25.1 |
Refseq Size | 1235 |
Refseq ORF | 783 |
Synonyms | HC9; HsT17706; PSC9 |
Summary | This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419117 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420186 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420187 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426193 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426194 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419117 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 |
USD 396.00 |
|
LY420186 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 |
USD 396.00 |
|
LY420187 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 |
USD 396.00 |
|
LY426193 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 |
USD 396.00 |
|
LY426194 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 |
USD 396.00 |
|
PH302786 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) |
USD 2,055.00 |
|
PH320385 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) |
USD 2,055.00 |
|
TP320385 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review