ASB3 (NM_145863) Human Recombinant Protein
CAT#: TP302814
Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2
View other "ASB3" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202814 protein sequence
Red=Cloning site Green=Tags(s) MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN YIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNG SHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL DKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNK VSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLA YCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL PRSLHNYLLYEDVLRMYEVPELAAIQDG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 49.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_665862 |
Locus ID | 51130 |
UniProt ID | Q9Y575 |
Cytogenetics | 2p16.2 |
Refseq Size | 2081 |
Refseq ORF | 1557 |
Synonyms | ASB-3 |
Summary | The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402502 | ASB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC407847 | ASB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402502 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 |
USD 396.00 |
|
LY407847 | Transient overexpression lysate of ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 2 |
USD 396.00 |
|
PH302814 | ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_665862) |
USD 2,055.00 |
|
PH316743 | ASB3 MS Standard C13 and N15-labeled recombinant protein (NP_057199) |
USD 2,055.00 |
|
TP316743 | Recombinant protein of human ankyrin repeat and SOCS box-containing 3 (ASB3), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review