TSSC3 (PHLDA2) (NM_003311) Human Recombinant Protein

CAT#: TP302884

Recombinant protein of human pleckstrin homology-like domain, family A, member 2 (PHLDA2)

Product Images

Coomassie blue staining of purified PHLDA2 protein (Cat# TP302884). The protein was produced from HEK293T cells transfected with PHLDA2 cDNA clone (Cat# RC202884) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202884 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF
  TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP
  SRPSPQPKPRTP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003302
• Locus ID: 7262
• UniProt ID: Q53GA4
• Cytogenetics: 11p15.4
• Refseq Size: 937
• Refseq ORF: 456
• Synonyms: BRW1C; BWR1C; HLDA2; IPL; TSSC3
• Summary: This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. [provided by RefSeq, Oct 2010]
• Protein Families: Druggable Genome