Twist (TWIST1) (NM_000474) Human Recombinant Protein

CAT#: TP302920

Recombinant protein of human twist homolog 1 (Drosophila) (TWIST1)

Product Images

Coomassie blue staining of purified TWIST1 protein (Cat# TP302920). The protein was produced from HEK293T cells transfected with TWIST1 cDNA clone (Cat# RC202920) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >Peptide sequence encoded by RC202920
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSP
  AQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTL
  PSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
  
  Recombinant protein using RC202920 also available, TP302920M
• Tag: C-Myc/DDK
• Predicted MW: 20.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000465
• Locus ID: 7291
• UniProt ID: Q15672
• Cytogenetics: 7p21.1
• Refseq Size: 1669
• Refseq ORF: 606
• Synonyms: ACS3; bHLHa38; BPES2; BPES3; CRS; CRS1; CSO; SCS; SWCOS; TWIST
• Summary: This gene encodes a basic helix-loop-helix (bHLH) transcription factor that plays an important role in embryonic development. The encoded protein forms both homodimers and heterodimers that bind to DNA E box sequences and regulate the transcription of genes involved in cranial suture closure during skull development. This protein may also regulate neural tube closure, limb development and brown fat metabolism. This gene is hypermethylated and overexpressed in multiple human cancers, and the encoded protein promotes tumor cell invasion and metastasis, as well as metastatic recurrence. Mutations in this gene cause Saethre-Chotzen syndrome in human patients, which is characterized by craniosynostosis, ptosis and hypertelorism. [provided by RefSeq, Jul 2020]
• Protein Families: Druggable Genome