ZKSCAN3 (NM_024493) Human Recombinant Protein

CAT#: TP302971

Recombinant protein of human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3)

Product Images

Coomassie blue staining of purified ZKSCAN3 protein (Cat# TP302971). The protein was produced from HEK293T cells transfected with ZKSCAN3 cDNA clone (Cat# RC202971) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202971 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL
  CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ
  GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPMLAHGGCCREDAVVASRLTPES
  QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH
  LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA
  FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
  TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT
  QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 60.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_077819
• Locus ID: 80317
• UniProt ID: Q9BRR0
• Cytogenetics: 6p22.1
• Refseq Size: 4725
• Refseq ORF: 1614
• Synonyms: dJ874C20.1; dJ874C20.1.; ZF47; zfp-47; Zfp47; ZFP306; ZNF306; ZNF309; ZSCAN13; ZSCAN35
• Summary: Transcriptional factor that binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. Associates with chromatin at the ITGB4 and VEGF promoters. Also acts as a transcription activator and promotes cancer cell progression and/or migration in various tumors and myelomas.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors