HYI (NM_031207) Human Recombinant Protein
CAT#: TP302991
Recombinant protein of human hydroxypyruvate isomerase homolog (E. coli) (HYI)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202991 protein sequence
Red=Cloning site Green=Tags(s) MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQE DLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQV AQVPGRGEPSSPGELNFPYLFQLLENEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRATQRLASEGPHTT HVPPDSE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112484 |
Locus ID | 81888 |
UniProt ID | Q5T013, Q5T013-3 |
Cytogenetics | 1p34.2 |
Refseq Size | 1251 |
Refseq ORF | 1365 |
Synonyms | HT036 |
Summary | This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410587 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434117 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410587 | Transient overexpression lysate of hydroxypyruvate isomerase homolog (E. coli) (HYI) |
USD 325.00 |
|
LY434117 | Transient overexpression lysate of hydroxypyruvate isomerase (putative) (HYI), transcript variant 3 |
USD 325.00 |
|
PH302991 | HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484) |
USD 2,055.00 |
|
TP331118 | Recombinant protein of human hydroxypyruvate isomerase (putative) (HYI), transcript variant 3. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review