MED31 (NM_016060) Human Recombinant Protein

CAT#: TP303047

Recombinant protein of human mediator complex subunit 31 (MED31)

Product Images

Coomassie blue staining of purified MED31 protein (Cat# TP303047). The protein was produced from HEK293T cells transfected with MED31 cDNA clone (Cat# RC203047) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203047 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP
  QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057144
• Locus ID: 51003
• UniProt ID: Q9Y3C7
• Cytogenetics: 17p13.1
• Refseq Size: 1656
• Refseq ORF: 393
• Synonyms: 3110004H13Rik; CGI-125; Soh1
• Summary: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors