MED31 (NM_016060) Human Recombinant Protein
CAT#: TP303047
Recombinant protein of human mediator complex subunit 31 (MED31)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203047 protein sequence
Red=Cloning site Green=Tags(s) MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYP QCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057144 |
Locus ID | 51003 |
UniProt ID | Q9Y3C7 |
Cytogenetics | 17p13.1 |
Refseq Size | 1656 |
Refseq ORF | 393 |
Synonyms | 3110004H13Rik; CGI-125; Soh1 |
Summary | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414225 | MED31 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414225 | Transient overexpression lysate of mediator complex subunit 31 (MED31) |
USD 325.00 |
|
PH303047 | MED31 MS Standard C13 and N15-labeled recombinant protein (NP_057144) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review