SR1 (SRI) (NM_003130) Human Recombinant Protein

CAT#: TP303130

Recombinant protein of human sorcin (SRI), transcript variant 1

Product Images

Coomassie blue staining of purified SRI protein (Cat# TP303130). The protein was produced from HEK293T cells transfected with SRI cDNA clone (Cat# RC203130) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203130 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF
  NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA
  VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003121
• Locus ID: 6717
• UniProt ID: P30626, B4DHQ6
• Cytogenetics: 7q21.12
• Refseq Size: 2036
• Refseq ORF: 594
• Synonyms: CP-22; CP22; SCN; V19
• Summary: This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. [provided by RefSeq, Mar 2012]
• Protein Families: Druggable Genome