SCLY (NM_016510) Human Recombinant Protein

CAT#: TP303164

Recombinant protein of human selenocysteine lyase (SCLY)

Product Images

Coomassie blue staining of purified SCLY protein (Cat# TP303164). The protein was produced from HEK293T cells transfected with SCLY cDNA clone (Cat# RC203164) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203164 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRK
  AKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFIT
  SSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEIS
  QRIKALNQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLY
  PMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFP
  GTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGR
  STTRAEVDLVVQDLKQAVAQLEDQA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057594
• Locus ID: 51540
• UniProt ID: Q96I15, B4DDP9, A0A0A0MQU4, Q59FK2
• Cytogenetics: 2q37.3
• Refseq Size: 2544
• Refseq ORF: 1335
• Synonyms: hSCL; SCL
• Summary: Selenocysteine lyase (SCLY; EC 4.4.1.16) catalyzes the pyridoxal 5-prime phosphate-dependent conversion of L-selenocysteine to L-alanine and elemental selenium (Mihara et al., 2000 [PubMed 10692412]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Metabolic pathways, Selenoamino acid metabolism