GAP43 (NM_002045) Human Recombinant Protein
CAT#: TP303175
Recombinant protein of human growth associated protein 43 (GAP43), transcript variant 2
View other "GAP43" proteins (3)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203175 protein sequence
Red=Cloning site Green=Tags(s) MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE AVDETKPKESARQDEGKEEEPEADQEHA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002036 |
| Locus ID | 2596 |
| UniProt ID | P17677, Q5U058 |
| Cytogenetics | 3q13.31 |
| Refseq Size | 1747 |
| Refseq ORF | 714 |
| Synonyms | B-50; GAP-43; PP46 |
| Summary | The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400750 | GAP43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400750 | Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 |
USD 436.00 |
|
| PH303175 | GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China