ISG20 (NM_002201) Human Recombinant Protein

CAT#: TP303178

Recombinant protein of human interferon stimulated exonuclease gene 20kDa (ISG20)

Product Images

Coomassie blue staining of purified ISG20 protein (Cat# TP303178). The protein was produced from HEK293T cells transfected with ISG20 cDNA clone (Cat# RC203178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
  AVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHK
  SIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVSD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002192
• Locus ID: 3669
• UniProt ID: Q96AZ6
• Cytogenetics: 15q26.1
• Refseq Size: 974
• Refseq ORF: 543
• Synonyms: CD25; HEM45
• Summary: Interferon-induced antiviral exoribonuclease that acts on single-stranded RNA and also has minor activity towards single-stranded DNA. Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV) and yellow fever virus (YFV) in an exonuclease-dependent manner. May also play additional roles in the maturation of snRNAs and rRNAs, and in ribosome biogenesis.[UniProtKB/Swiss-Prot Function]