RNF34 (NM_025126) Human Recombinant Protein
CAT#: TP303191
Recombinant protein of human ring finger protein 34 (RNF34), transcript variant 2
View other "RNF34" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203191 protein sequence
Red=Cloning site Green=Tags(s) MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVCKACGLSFS VFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLILRNIPIDTCREK EDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSSFQGELMDGDQTSRSGVPA QVQSEITSANTEDDDDDDDEDDDDEEENAEDRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNF VNYSGCCEKWELVEKVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCG KRMSECPICRQYVVRAVHVFKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079402 |
Locus ID | 80196 |
UniProt ID | Q969K3 |
Cytogenetics | 12q24.31 |
Refseq Size | 2055 |
Refseq ORF | 1116 |
Synonyms | CARP-1; CARP1; hRFI; RFI; RIF; RIFF |
Summary | The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403050 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403664 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430675 | RNF34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403050 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 2 |
USD 396.00 |
|
LY403664 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 1 |
USD 396.00 |
|
LY430675 | Transient overexpression lysate of ring finger protein 34 (RNF34), transcript variant 1 |
USD 396.00 |
|
PH303191 | RNF34 MS Standard C13 and N15-labeled recombinant protein (NP_079402) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review