PCTP L (STARD10) (NM_006645) Human Recombinant Protein

CAT#: TP303228

Recombinant protein of human StAR-related lipid transfer (START) domain containing 10 (STARD10)

Product Images

Coomassie blue staining of purified STARD10 protein (Cat# TP303228). The protein was produced from HEK293T cells transfected with STARD10 cDNA clone (Cat# RC203228) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203228 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKC
  RMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMG
  ADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPK
  AMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAG
  GEGSDDDTSLT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006636
• Locus ID: 10809
• UniProt ID: Q9Y365, A0A024R5L8
• Cytogenetics: 11q13.4
• Refseq Size: 1988
• Refseq ORF: 873
• Synonyms: CGI-52; NY-CO-28; PCTP2; SDCCAG28
• Summary: May play metabolic roles in sperm maturation or fertilization (By similarity). Phospholipid transfer protein that preferentially selects lipid species containing a palmitoyl or stearoyl chain on the sn-1 and an unsaturated fatty acyl chain (18:1 or 18:2) on the sn-2 position. Able to transfer phosphatidylcholine (PC) and phosphatidyetanolamline (PE) between membranes.[UniProtKB/Swiss-Prot Function]