Phospholipase A2 IIA (PLA2G2A) (NM_000300) Human Recombinant Protein

CAT#: TP303250

Recombinant protein of human phospholipase A2, group IIA (platelets, synovial fluid) (PLA2G2A)

Product Images

Coomassie blue staining of purified PLA2G2A protein (Cat# TP303250). The protein was produced from HEK293T cells transfected with PLA2G2A cDNA clone (Cat# RC203250) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203250 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCC
  YKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGS
  TPRC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000291
• Locus ID: 5320
• UniProt ID: P14555, A0A024RA96
• Cytogenetics: 1p36.13
• Refseq Size: 1017
• Refseq ORF: 432
• Synonyms: MOM1; PLA2; PLA2B; PLA2L; PLA2S; PLAS1; sPLA2
• Summary: The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5' UTRs have been found for this gene.[provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway